Escherichia coli K-12

UniProt Data

Accession P0AES9 [ UniProt ]
Name HDEA_ECOLI
Description 10K-S protein
Species Escherichia coli K-12
Sequence Length110

Enzyme Annotations (0)

    GO Annotations

    Cellular component (1)

    None predicted

    Molecular function (1)

    None predicted

    Biological process (1)

    None predicted

    Protein Sequence

    >P0AES9
    MKKVLGVILGGLLLLPVVSNAADAQKAADNKKPVNSWTCEDFLAVDESFQPTAVGFAEALNNKDKPEDAVLDVQGIATVT
    PAIVQACTQDKQANFKDKVKGEWDKIKKDM